PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi001847
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family G2-like
Protein Properties Length: 402aa    MW: 44863.5 Da    PI: 7.9497
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Picea_sitchensis-19632PU_refplantGDBView CDS
gnl|UG|Psi#S50822513PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.61.4e-3348102155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                kprlrWtpeLHerFv+av+qLGG++kAtPk++l+ m+vkgLtl+h+kSHLQkYRl
  Psi001847  48 KPRLRWTPELHERFVDAVSQLGGPDKATPKSVLREMGVKGLTLYHLKSHLQKYRL 102
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.46345105IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-3246103IPR009057Homeodomain-like
SuperFamilySSF466893.76E-1748103IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2448103IPR006447Myb domain, plants
PfamPF002492.7E-1050101IPR001005SANT/Myb domain
PfamPF143791.8E-23144191IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MEYPSNPGIV LNHGRAPSQP ERQHQQPALT GSSHYPCDPG VVVSADPKPR LRWTPELHER  60
FVDAVSQLGG PDKATPKSVL REMGVKGLTL YHLKSHLQKY RLGKQPHREV SVDRSNDGGS  120
SDGGHCLSRM ARDSSITPNH KEAMQIADAL RAQIEVQRRL HDQLEVQRRL QLRIEAQGKY  180
LQAILEKAQQ TLASEASTSA GIEATRAKLA DLASKLPTNS VRPNYSAMKV APLMDMHRQD  240
HRDLELKPHL RDRCSQNQFA SHDMEQSLNE SESPIEKKRC RKLFHESNGG NSPTKLRELG  300
LNASACKTEE EEDEEEEQLI KPTTVERPAA TRALVDERMA MLVQSNGLSL IQANHEPGLY  360
HPPSMLGNCR KVAEGLDLNR KGEGSVPQQG RELDLNAYGW GR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1275282EKKRCRKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006369801.12e-70hypothetical protein POPTR_0001s32200g
STRINGPP1S33_139V6.12e-68(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.14e-70G2-like family protein